dadsflix.com Dads Flix Sex Videos - Free Collection of Family Porn Movies

dadsflix.com
Title: Dads Flix Sex Videos - Free Collection of Family Porn Movies
Keywords: dads flix, sex tube, free sex, hot girls, sexy girls, free porn, free sex photos, free sex movies, free sex video, free porn photos, free porn movies, free porn video, free xxx, incest, old and young...
Description: Dads Flix Sex Videos is the hottest family porn tube, this is definitely the site for you to see! No messing around here guys, this isn't one of those lame streaming porn websites that have crappy quality sex videos with tons of missing niches!
dadsflix.com is ranked 720857 in the world (amongst the 40 million domains). A low-numbered rank means that this website gets lots of visitors. This site is relatively popular among users in the united states. It gets 50% of its traffic from the united states .This site is estimated to be worth $126,119. This site has a low Pagerank(0/10). It has 1 backlinks. dadsflix.com has 43% seo score.

dadsflix.com Information

Website / Domain: dadsflix.com
Website IP Address: 192.243.50.144
Domain DNS Server: ns2.crunkmovies.com,ns1.crunkmovies.com

dadsflix.com Rank

Alexa Rank: 720857
Google Page Rank: 0/10 (Google Pagerank Has Been Closed)

dadsflix.com Traffic & Earnings

Purchase/Sale Value: $126,119
Daily Revenue: $345
Monthly Revenue $10,365
Yearly Revenue: $126,119
Daily Unique Visitors 31,789
Monthly Unique Visitors: 953,670
Yearly Unique Visitors: 11,602,985

dadsflix.com WebSite Httpheader

StatusCode 200
Content-Type text/html; charset=utf-8
Date Tue, 09 Aug 2016 21:31:29 GMT
Server nginx/1.10.1

dadsflix.com Keywords accounting

Keyword Count Percentage
dads flix 2 0.18%
sex tube 5 0.40%
free sex 1 0.08%
hot girls 0 0.00%
sexy girls 0 0.00%
free porn 1 0.09%
free sex photos 0 0.00%
free sex movies 0 0.00%
free sex video 1 0.14%
free porn photos 0 0.00%
free porn movies 0 0.00%
free porn video 0 0.00%
free xxx 0 0.00%
incest 0 0.00%
old and young... 0 0.00%

dadsflix.com Traffic Sources Chart

dadsflix.com Similar Website

Domain Site Title

dadsflix.com Alexa Rank History Chart

dadsflix.com aleax

dadsflix.com Html To Plain Text

Dads Flix Sex Videos - Free Collection of Family Porn Movies Dads Flix Sex Videos is the hottest family porn tube site, this is definitely the site for you to see! No messing around here guys, this isn't one of those lame streaming porn websites that have crappy quality videos with tons of missing niches. This sex tube site has the biggest family porn database out there and the hottest collection of porn videos that will leave you shocked! There are so many hot niches here that you will find whatever sort of action you're lookin for. There are tons of daily updates and heaps more. Check out the free tube movies right here! Home Page Date -any date-TodayYesterday2 days ago3 days ago4 days ago5 days ago6 days agoLast WeekWeek Ago Dur -any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes> 90 minutes Tube -any tube-aShemaleTubebigXvideosDrTuberHardsextubeHDpornNuvidOverThumbsPornerBrosPornHubSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn Age -all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung Country -all countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish Tiny 20408 Tiny Sex Videos Old Young 30881 Old Young Sex Videos Perverted 24070 Perverted Sex Videos Vintage 32978 Vintage Sex Videos Japanese 92352 Japanese Sex Videos Amateur 680592 Amateur Sex Videos 18 Year Old 27628 18 Year Old Sex Videos Teen 653205 Teen Sex Videos Forced 3889 Forced Sex Videos Barely Legal 22296 Barely Legal Sex Videos Mature 340125 Mature Sex Videos Old Man 9842 Old Man Sex Videos Lesbian 195538 Lesbian Sex Videos Voyeur 108217 Voyeur Sex Videos Ass 293985 Ass Sex Videos Black 164914 Black Sex Videos Public 179333 Public Sex Videos Milf 171567 Milf Sex Videos Orgasm 61163 Orgasm Sex Videos Gay 212608 Gay Sex Videos Ebony 189288 Ebony Sex Videos Cum 183399 Cum Sex Videos Tranny 115710 Tranny Sex Videos Handjob 96672 Handjob Sex Videos Home Made 96190 Home Made Sex Videos German 22870 German Sex Videos Blowjob 1017826 Blowjob Sex Videos Tits 504175 Tits Sex Videos Big Tits 404016 Big Tits Sex Videos Masturbating 307040 Masturbating Sex Videos Asian 194032 Asian Sex Videos Bdsm 155404 Bdsm Sex Videos Pornstar 131836 Pornstar Sex Videos Hairy 116849 Hairy Sex Videos Big Ass 105340 Big Ass Sex Videos Shemale 95896 Shemale Sex Videos Party 78450 Party Sex Videos Strap On 76314 Strap On Sex Videos College Girl 67360 College Girl Sex Videos Creampie 66496 Creampie Sex Videos Wife 56484 Wife Sex Videos Hidden Cam 33250 Hidden Cam Sex Videos Teacher 15699 Teacher Sex Videos Italian 8842 Italian Sex Videos Hardcore 797799 Hardcore Sex Videos Fetish 653414 Fetish Sex Videos Pussy 406373 Pussy Sex Videos Group Sex 258061 Group Sex Sex Videos Big Cock 240560 Big Cock Sex Videos Bbw 148285 Bbw Sex Videos 3some 130708 3some Sex Videos Beauty 117675 Beauty Sex Videos Cute 100518 Cute Sex Videos Solo 100027 Solo Sex Videos Webcam 99502 Webcam Sex Videos Reality 98584 Reality Sex Videos Mature Amateur 91520 Mature Amateur Sex Videos Latina 91437 Latina Sex Videos Outdoor 84400 Outdoor Sex Videos Huge Tits 82454 Huge Tits Sex Videos Couple 80079 Couple Sex Videos Lingerie 75839 Lingerie Sex Videos Stockings 74159 Stockings Sex Videos Huge Cock 71004 Huge Cock Sex Videos Hd 68756 Hd Sex Videos Russian 64305 Russian Sex Videos Student 57733 Student Sex Videos Massage 55108 Massage Sex Videos Sperm 54660 Sperm Sex Videos Lesbian Teen 51485 Lesbian Teen Sex Videos Jerking 50821 Jerking Sex Videos Clit 48763 Clit Sex Videos Bisexual 44049 Bisexual Sex Videos Big Black Cock 43633 Big Black Cock Sex Videos Mature Lesbian 41327 Mature Lesbian Sex Videos Femdom 39268 Femdom Sex Videos Deepthroat 37774 Deepthroat Sex Videos Bedroom 37395 Bedroom Sex Videos Panties 36496 Panties Sex Videos Cuckold 35967 Cuckold Sex Videos Gangbang 34846 Gangbang Sex Videos Cum In Mouth 32641 Cum In Mouth Sex Videos Bizarre 31287 Bizarre Sex Videos Casting 29324 Casting Sex Videos Missionary 27158 Missionary Sex Videos Prostitute 25018 Prostitute Sex Videos Big Natural Tits 24683 Big Natural Tits Sex Videos Slave 24233 Slave Sex Videos Anal Creampie 22838 Anal Creampie Sex Videos Small Cock 22742 Small Cock Sex Videos Fisting 22447 Fisting Sex Videos Natural Boobs 20759 Natural Boobs Sex Videos Humiliation 19925 Humiliation Sex Videos Housewife 19127 Housewife Sex Videos Chubby 19018 Chubby Sex Videos Pantyhose 18984 Pantyhose Sex Videos Nudist 18771 Nudist Sex Videos Seduce 18748 Seduce Sex Videos Squirt 18233 Squirt Sex Videos Anal Fisting 16841 Anal Fisting Sex Videos Compilation 16170 Compilation Sex Videos 19 Year Old 15450 19 Year Old Sex Videos French 15292 French Sex Videos Office 15045 Office Sex Videos Upskirt 14904 Upskirt Sex Videos Gloryhole 14606 Gloryhole Sex Videos Fat Teen 14526 Fat Teen Sex Videos Monster Cock 14417 Monster Cock Sex Videos Car 13952 Car Sex Videos Brazilian 13798 Brazilian Sex Videos Crossdressing 13308 Crossdressing Sex Videos Bathroom 13190 Bathroom Sex Videos Plumper 12834 Plumper Sex Videos African 12214 African Sex Videos Indian 12172 Indian Sex Videos Czech 12055 Czech Sex Videos Game 12023 Game Sex Videos Gym 11626 Gym Sex Videos 69 11604 69 Sex Videos Aged 11366 Aged Sex Videos Anime 10858 Anime Sex Videos Swinger 10718 Swinger Sex Videos Beach 10716 Beach Sex Videos Double Fucking 10671 Double Fucking Sex Videos Chinese 10587 Chinese Sex Videos Kitchen 9829 Kitchen Sex Videos Classic 9817 Classic Sex Videos Cash 9342 Cash Sex Videos Nurse 9285 Nurse Sex Videos Spy 8969 Spy Sex Videos Doctor 7982 Doctor Sex Videos Arabian 7564 Arabian Sex Videos Fat Mature 7387 Fat Mature Sex Videos Korean 7091 Korean Sex Videos Thai 6518 Thai Sex Videos 3d 6353 3d Sex Videos Open Pussy 6201 Open Pussy Sex Videos Hotel 6122 Hotel Sex Videos Boss 5969 Boss Sex Videos Tied Up 5858 Tied Up Sex Videos Milk 5753 Milk Sex Videos Husband 5447 Husband Sex Videos Cheating 5441 Cheating Sex Videos Babysitter 5307 Babysitter Sex Videos Secretary 5180 Secretary Sex Videos Face Sitting 5157 Face Sitting Sex Videos Maid 4839 Maid Sex Videos Story 4217 Story Sex Videos Bus 4215 Bus Sex Videos Pain 4162 Pain Sex Videos Old Young Lesbian 3768 Old Young Lesbian Sex Videos Retro 3504 Retro Sex Videos Turkish 3279 Turkish Sex Videos Mature Teacher 3192 Mature Teacher Sex Videos Forest 3085 Forest Sex Videos 10+ Inch Cock 3056 10+ Inch Cock Sex Videos Mexican 3027 Mexican Sex Videos Old Farts 2688 Old Farts Sex Videos Police 2440 Police Sex Videos Surprise 2320 Surprise Sex Videos Sleeping 2306 Sleeping Sex Videos Hospital 2101 Hospital Sex Videos Filipina 1866 Filipina Sex Videos Rocco 1569 Rocco Sex Videos Hungarian 1566 Hungarian Sex Videos Bride 1545 Bride Sex Videos Fleshlight 1382 Fleshlight Sex Videos Ugly 1273 Ugly Sex Videos Prostate 1177 Prostate Sex Videos Female Ejaculation 1051 Female Ejaculation Sex Videos Midget 1051 Midget Sex Videos Saggy Tits 940 Saggy Tits Sex Videos Lactating 774 Lactating Sex Videos Nun 725 Nun Sex Videos Farm 706 Farm Sex Videos Pakistani 634 Pakistani Sex Videos Indonesian 407 Indonesian Sex Videos Cinema 398 Cinema Sex Videos Alien 270 Alien Sex Videos Hermaphrodite 154 Hermaphrodite Sex Videos Date -any date-TodayYesterday2 days ago3 days ago4 days ago5 days ago6 days agoLast WeekWeek Ago Dur -any len-0..5 minutes5..20 minutes20..40 minutes40..60 minutes60..90 minutes> 90 minutes Tube -any tube-aShemaleTubebigXvideosDrTuberHardsextubeHDpornNuvidOverThumbsPornerBrosPornHubSunPornoTube8VID2CXhamsterXVideosXXXKinKyYobtYouPorn Age -all ages-18 year old19 year olddadgrannyinnocentmaturemilfmommothernunschoolgirlsisterteenuniversityvirginyoung Country -all countries-africanamericanargentinianbrazilianbritishchinesecubanczechdutchegyptianfilipinafinnishfrenchgermangreekhawaiianindianindonesianitalianjapanesekoreanmexicanpakistanipolishrussianspanishswedishthaiturkish Most Popular Tubes From Daddy's Porn Collection Search . Anal accident . Anal pain . Arabic sex . Arrimon . Asian milfs . Asshole . Aubey addams . Bang wife . Beasts . Born . British moms . Busty handjob . Coste melanie . Daddy anal . Dads . Dalny . Dirty talk . Dont cum . Fad . Gay cum mouth . Interracial wife . Japanese dad daughter . Jerk for me . Mature facial . Medical fucker . Michelle wild . Milf younger guy . Mom son secrets . Mom son sleeping . Mother breasts . My dirty hobby . Nos . Siffredi . Spit feet . Suz . Tug . Ursula andress . Wife used . Woods rough . Young isabella Free Sex Videos Today top tube Pornstars listing Search A B C D E F G H I J K L M N O P Q R S T U V W X Y Z . Amirah . Angela . Babette Blue . Bell . Bettini Di Capri . Chad . Cinthia Fernandez . Dancing Bear . Devi Emerson . Jerilyn Paige . Jhenifer . Jordyn Peaks . Kerry Marie . Krystal Lynn Lovely . Laura Palmer . Leonelle . Liza Del Sierra . Mandy Mystery . Marli Jane . Mery . Mia Banggs . Mindy Main . Monika Vesela . Pampushka . Penelope Sky . Rill Rapz . Satomi Maeno . Tawny Roberts . Teen Emery . Tia Sweets . Vania . Veronica Da Souza A B C D E F G H I J K L M N O P Q R S T U V W X Y Z Free Pornstar Videos Top List of Porn Tube Sites 1-5 01 Creampie Tube Porn 02 Xxx Sex Anal 03 Free Moms Sex 04 Xxx Fuck Porn 05 Video-One Tube 6-10 06 Hot Milf Clips 07 Hard Porn 08 Redtube Porn 09 Sfico 10 Naked Matures 11-15 11 Paris Tube Porn 12 Mom Tube Sex 13 Moms Fuck 14 Xhamster 15 Xhamster Porn 16-20 16 Wife Porno Movies 17 Mature Videos Porn 18 Mrs Sex Tube 19 Anal Sex Tube 20 Hard Porn 21-25 21 Mag Post 22 Sex Mom Fuck 23 Best Sex Tube 24 Free Mature Sex 25 Homemade Xxx Daddy Porn is a kind of search engine that automatically generates sex tube videos. We'd like to emphasize that we don't shoot content you may find on this website. Our script auto generates links with porn videos and thumbs and adds them to the list on our website. l Abuse (c) 2008 Family Porn

dadsflix.com Whois

Domain Name: DADSFLIX.COM
Registry Domain ID: 1540609281_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: www.enom.com
Updated Date: 2014-04-11T04:51:43.00Z
Creation Date: 2009-02-03T12:16:00.00Z
Registrar Registration Expiration Date: 2018-02-03T12:16:00.00Z
Registrar: ENOM, INC.
Registrar IANA ID: 48
Reseller: NAMECHEAP.COM
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: JORDY PIETERS
Registrant Organization: N/A
Registrant Street: SERINGSTRAAT 18 APT. 9
Registrant City: EDERVEEN
Registrant State/Province: GELDERLAND
Registrant Postal Code: 6744 WZ
Registrant Country: NL
Registrant Phone: +31.1318571462
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: WEB@KAZATUBE.COM
Registry Admin ID:
Admin Name: JORDY PIETERS
Admin Organization: N/A
Admin Street: SERINGSTRAAT 18 APT. 9
Admin City: EDERVEEN
Admin State/Province: GELDERLAND
Admin Postal Code: 6744 WZ
Admin Country: NL
Admin Phone: +31.1318571462
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: WEB@KAZATUBE.COM
Registry Tech ID:
Tech Name: JORDY PIETERS
Tech Organization: N/A
Tech Street: SERINGSTRAAT 18 APT. 9
Tech City: EDERVEEN
Tech State/Province: GELDERLAND
Tech Postal Code: 6744 WZ
Tech Country: NL
Tech Phone: +31.1318571462
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: WEB@KAZATUBE.COM
Name Server: NS1.CRUNKMOVIES.COM
Name Server: NS2.CRUNKMOVIES.COM
DNSSEC: unSigned
Registrar Abuse Contact Email: abuse@enom.com
Registrar Abuse Contact Phone: +1.4252982646
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
Last update of WHOIS database: 2014-04-11T04:51:43.00Z
The data in this whois database is provided to you for information
purposes only, that is, to assist you in obtaining information about or
related to a domain name registration record. We make this information
available "as is," and do not guarantee its accuracy. By submitting a
whois query, you agree that you will use this data only for lawful
purposes and that, under no circumstances will you use this data to: (1)
enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or (2) allow,
enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic
mail, or by telephone. The compilation, repackaging, dissemination or
other use of this data is expressly prohibited without prior written
consent from us.
We reserve the right to modify these terms at any time. By submitting
this query, you agree to abide by these terms.
Version 6.3 4/3/200